IGF-1LR3.
IGF-1 LR3 is a long arginine 3 IGF-1, a recombinant IGF-1 analog with an N-terminal extension and Arg3 substitution. With the molecular formula C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₆ and a molecular weight of 9111.6 g/mo...
Lab Verified
Clinical Grade
PMID Cited
Mechanism of Action.
Published preclinical research has characterized the following molecular pathways and receptor interactions for IGF-1LR3.
IGF-1 Receptor
Published research demonstrates IGF-1 LR3 modulates targeted signaling cascades within cell tissue models.
PI3K/AKT Signaling Pathway
In cellular environments, IGF-1 LR3 exhibits selective binding and corresponding pathway activation.
Clinical Literature
Research review on IGF-1LR3 molecular characterization.
Preclinical studies have characterized the molecular properties and receptor binding profiles of IGF-1LR3 in standardized assay systems.
IGF-1LR3 structure-activity relationship analysis.
Structure-activity relationship studies have examined the functional domains and binding characteristics of IGF-1LR3 in cell-free and cell-based systems.
Compound Data
| CAS Number | 946870-92-4 |
|---|---|
| Molecular Formula | C400H625N111O115S9 |
| Molecular Weight | 9117.5 g/mol |
| Sequence | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGSTFEEHK |
| Purity | ≥99% (HPLC verified) |
| Form | Lyophilized powder |
| Storage | −20°C · Lyophilized |
IGF-1LR3 Questions
What is IGF-1LR3 used for?
IGF-1LR3 is a research compound studied in laboratory settings. It has molecular formula C400H625N111O115S9, a molecular weight of 9117.5 g/mol, CAS 946870-92-4. Scientific literature has explored its properties in preclinical studies. For research purposes only. Not for human use.
What purity level does Evo Amino's IGF-1LR3 have?
Evo Amino supplies IGF-1LR3 at ≥99% purity, verified by third-party HPLC and mass spectrometry analysis. Certificates of Analysis are available upon request.
How is IGF-1LR3 supplied?
IGF-1LR3 is supplied as a lyophilized powder in sealed research-grade vials, intended for in vitro and laboratory research use only.
RESEARCH USE ONLY: This compound is intended exclusively for in vitro laboratory research. Not for human or veterinary use. Not intended to diagnose, treat, cure, or prevent any disease. Not evaluated by the FDA. Must be 21+ to purchase.
Related Compounds.
HealingARA-290
$102.00C51H84N16O21 · 1257.3 g/mol
For in vitro research use only. Not for human consumption.
HealingBPC-157
$32.00C62H98N16O22 · 1419.56 g/mol
For in vitro research use only. Not for human consumption.
HealingBPC/TB500
$57.00Blend · Mixed
For in vitro research use only. Not for human consumption.