For research purposes only
Research Library
Documentation on compound structure, mechanisms, analytical verification, and the research peptide market. Every article cites peer-reviewed literature and is written for research use only.
GLP-1 Sequence, Molecular Weight, and Structure: A Reference FAQ
GLP-1 (7-37) is a 31-residue peptide, HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG, with the molecular formula C₁₅₁H₂₂₆N₄₀O₄₆ and a molecular weight of 3337.73 g/mol (CAS 106612-94-6). Twelve reference questions on its sequence, the 7-36 amide variant, proglucagon processing, DPP-4 cleavage, fusion proteins, and how analogs change the mass. For research purposes only.
Ipamorelin vs Other GH Secretagogues: CJC-1295 No DAC and Tesamorelin Research Comparison
Ipamorelin is a 711.9 g/mol pentapeptide ghrelin mimetic acting at GHS-R1a, while CJC-1295 no DAC (3367.9 g/mol) and tesamorelin (5135.9 g/mol) are GHRH-receptor analogs. A structure and receptor-class comparison of the three, with a table, covering selectivity, half-life, why the two classes are studied together, and analytical considerations. For research purposes only.
Melanotan 1 vs Melanotan 2: Structure, Receptor Selectivity, and Research Comparison
Melanotan 1 (afamelanotide) is a linear 13-residue alpha-MSH analog (1646.8 g/mol) focused on MC1R, while Melanotan 2 is a cyclic lactam-bridged heptapeptide (1024.2 g/mol) with broader melanocortin receptor activity. A structure-first comparison covering the Nle4 and D-Phe7 substitutions, the cyclic constraint, receptor subtype selectivity, regulatory status, and what published research has measured for each. For research purposes only.
Paradigm Peptides Alternative: What Researchers Should Verify First (2026)
Paradigm Peptides ended in a federal criminal case; court coverage reports forged lab certificates among the findings. Here is the verification checklist that case argues for, and how Evo Amino documents every batch. For research purposes only.
What Happened to Paradigm Peptides? The Federal Case, Explained (2026)
Paradigm Peptides is permanently closed. Owner Matthew Kawa pleaded guilty in December 2025 and was sentenced in July 2026 to 70 months in prison, per the DOJ. The documented timeline and what it means for researchers.
GHK-Cu vs Matrixyl: A Research Comparison of the Two Most-Studied Cosmetic-Science Peptides
A structural and mechanistic research comparison of GHK-Cu, the copper-binding tripeptide, and Matrixyl (palmitoyl pentapeptide-4), the collagen-fragment matrikine — covering their distinct signaling mechanisms in fibroblast models, the topical-delivery literature, and how researchers select between them for skin-model studies. For research purposes only.
BPC-157 vs Follistatin: A Research Comparison
A structural and mechanistic comparison of BPC-157 and Follistatin across molecular class, receptor biology, and documented in vitro research applications in tissue-repair and growth-factor signaling contexts. For research purposes only.
5-Amino-1MQ: NNMT Inhibition, NAD⁺ Metabolism, and Research Overview
A research overview of 5-Amino-1MQ, a small-molecule nicotinamide N-methyltransferase (NNMT) inhibitor studied for its role in NAD⁺ metabolism, methyl donor pathways, and adipogenesis research models. For research purposes only.
AOD9604 (Fragment 176-191): Molecular Structure, Receptor Interactions, and Research Overview
A research overview of AOD9604, a synthetic peptide corresponding to the C-terminal fragment of human growth hormone residues 176–191. Covers molecular structure, the disulfide bridge, receptor interactions, and how it differs from intact hGH in research models. For research purposes only.
BPC-157 vs GLP-1: Structural Classes, Mechanisms, and Research Applications Compared
A head-to-head structural and mechanistic comparison of BPC-157 and GLP-1 across their distinct research classes, receptor biology, and documented in vitro applications. For research purposes only.
US Domestic vs. Overseas Research Peptide Sourcing: What Quality Data Shows in 2026
A factual guide to what distinguishes domestically sourced research peptides from overseas-manufactured alternatives—covering manufacturing accountability, quality documentation, shipping logistics, and what researchers should verify before selecting a supplier.
BPC-157 in Angiogenesis and Endothelial Signaling Research
The vascular thread of the BPC-157 literature runs through nitric oxide synthase, the NO-cGMP axis, and VEGF signaling in endothelial culture. What each assay measures, why endothelial models are used, and what the published findings do and do not establish. For research purposes only.
Peptide Batch Traceability: Connecting a Vial to Its Production Lot
Batch numbers are the link between the vial on the bench and the records behind it. How lot coding works, what a traceable chain contains, and how to audit whether a supplier's traceability is real.
How GLP-1 Receptor Binding Is Measured: Assay Methods and Their Limits
Radioligand binding, fluorescence polarization, surface plasmon resonance, BRET, and structural methods each answer a different question about receptor engagement. What each measures, what Kd and competition data establish, and where the methods disagree. For research purposes only.
Co-Elution in Peptide HPLC: Why a 99% Purity Number Can Hide Impurities
Chromatographic purity counts what the method separates. Impurities that co-elute with the target are counted as target. How co-elution happens, which impurities it hides, and the orthogonal methods that catch them.
Moisture, Glass Transition, and Why Lyophilized Peptides Fail Quietly
Residual water in a lyophilized cake acts as a plasticizer, lowering the temperature at which the solid matrix loses its glassy state. Why moisture and heat reinforce each other, what cake collapse indicates, and how residual moisture is measured. For research purposes only.
Neuroactive Peptides: Semax, Selank & Dihexa
Research-focused comparison of Semax, Selank, and Dihexa examining BDNF modulation, anxiolytic mechanisms, HGF/c-Met signaling, and neuroprotective findings in published literature.
GH Secretagogue Peptides: Research Specs
Molecular comparison of GHS peptides including CJC-1295, Ipamorelin, Sermorelin, and Tesamorelin. Receptor binding sequences, pharmacokinetic modifications, and published pituitary receptor findings.
Longevity Peptides: Epitalon & GHK-Cu Research
Research comparison of Epitalon, FOXO4-DRI, and GHK-Cu examining telomerase activation, senescent cell clearance, and copper-peptide tissue remodeling in published scientific literature.
Metabolic Peptides: GLP-1, GIP & Dual Agonists
A research-focused comparison of GLP-1, GIP, and dual GIP/GLP-1 agonist peptides including tirzepatide, examining receptor binding, metabolic mechanisms, and published research outcomes.
Quality Documentation in Peptide Research
Critical assessment of quality documentation in the research peptide industry. Analysis of CLIA certification, GMP compliance, and Specification Standard requirements for research compound verification.
Regenerative Peptides: BPC-157, TB-500 & More
Molecular analysis comparing regenerative research peptides: BPC-157, TB-500, and Epitalon. Detailed review of amino acid sequences, signaling mechanisms, and structural data from peer-reviewed literature.